RP-HPLC comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-11-10. Where a claim depends on a specific study, the study is described rather than over-claimed.
The two variants differ dramatically in how long they persist in circulation. The form lacking the albumin-binding group has a plasma half-life measured in tens of minutes, comparable to the natural hormone fragment. The version carrying the drug affinity complex binds albumin and shows a half-life of roughly six to eight days in human studies. That figure comes from small trials that tracked hormone levels over extended periods. The physiological consequences of sustained versus pulsatile stimulation are still debated and the literature does not settle the point.
Lyophilized peptide powder is comparatively stable when kept dry, cold, and protected from light. Once dissolved, the molecule is vulnerable to deamidation, oxidation, and aggregation, with the rate depending on pH, buffer composition, and temperature. Alkaline conditions and repeated freeze-thaw cycles accelerate loss of the intact peptide. The methionine present in the native sequence is a known oxidation site, which is one reason it was replaced in the modified fragment. Suppliers typically recommend cold storage of solutions and use within a short window.
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography combined with mass spectrometry. The chromatographic separation resolves the target peptide from truncation products and from species carrying oxidised residues, while mass measurement confirms the expected molecular mass. Because the two common variants differ by roughly 280 daltons, a mass determination distinguishes them unambiguously. Purity is often quoted as a percentage of total peak area, although that figure depends on the detection wavelength and the integration method applied.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 3.4 to 3.6 kDa | Depends on whether the affinity complex is attached |
| Appearance | White to off-white lyophilized powder | Freeze-dried solid, often in a sealed vial |
| Solubility | Soluble in water and aqueous buffers | Dissolution rate varies with pH and buffer salt |
| Typical storage | Below minus 20 degrees Celsius, dry and dark | Dissolved material is usually kept cold and used promptly |
| Common analytical methods | Reversed-phase HPLC and mass spectrometry | Peptide mapping and amino acid analysis add sequence detail |
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
Binding of the peptide to the growth hormone-releasing hormone receptor on pituitary somatotrophs triggers a G protein coupled cascade that raises cyclic AMP and opens calcium channels. The result is greater secretion of growth hormone into the bloodstream. Because the peptide acts at the same receptor as the natural hypothalamic hormone, its effect is amplified pulse size rather than an entirely separate release pathway. Receptor binding alone does not determine the response, since somatostatin tone and other inputs modulate the final output.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
Studies in this area generally track growth hormone pulses, insulin-like growth factor 1 concentrations, and occasionally body composition endpoints. Most published human data come from early, small trials, and questions about long-term effects remain open. Whether repeated exposure alters pituitary responsiveness over time is not settled. Analytical work relies on immunoassays for the hormones and on mass spectrometry for the peptide itself, because the two measurements answer different questions.
Media related to Bananas and plantains as food at Wikimedia Commons Musapedia: "The banana knowledge compendium", maintained by ProMusa CGIAR's RTB Research Program Banana Page Banana and Plantain at the International Institute of Tropical Agriculture (IITA)
== Availability == PRRT is not yet widely available, with various radiopharmaceuticals at different stages of clinical trials. The cost of small volume production of the relevant radionuclides is high. The cost of Lutathera, a commercial 177Lu-DOTATATE product, has been quoted by the manufacturer as £71,500 (€80,000 or $94,000 in July 2018) for 4 administrations of 7.4 GBq.
== History == In 1909 Minnie Evangeline Jordon established the first dental practice in the United States devoted only to pediatric patients. In 1925 she published the first textbook on pediatric dentistry, titled Operative Dentistry for Children. The first dental care brought to public school was Alfred Fones in 1914, which was near 6 decades after the first woman, Lucy Hobbs Taylor, who received a DDS.
Sources: en.wikipedia.org
In addition, those with hyperthyroidism may present with a variety of physical symptoms such as palpitations and abnormal heart rhythms (the notable ones being atrial fibrillation), shortness of breath (dyspnea), loss of libido, amenorrhea, nausea, vomiting, diarrhea, gynecomastia and feminization. Long term untreated hyperthyroidism can lead to osteoporosis. These classic symptoms may not be present often in the elderly. Bone loss, which is associated with overt but not subclinical hyperthyroidism, may occur in 10 to 20% of patients. This may be due to an increase in bone remodelling and a decrease in bone density, which increases fracture risk. It is more common in postmenopausal women; less so in younger women and men. Bone disease related to hyperthyroidism was first described by Frederick von Recklinghausen in 1891; he described the bones of a woman who died of hyperthyroidism as appearing "worm-eaten".
=== Safranine === Safranine (or Safranine O) is a red cationic dye. It binds to nuclei (DNA) and other tissue polyanions, including glycosaminoglycans in cartilage and mast cells, and components of lignin and plastids in plant tissues. Safranine should not be confused with saffron, an expensive natural dye that is used in some methods to impart a yellow colour to collagen, to contrast with blue and red colours imparted by other dyes to nuclei and cytoplasm in animal (including human) tissues. The incorrect spelling "safranin" is in common use. The -ine ending is appropriate for safranine O because this dye is an amine.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Schiller (1969), lawyer, co-founder of Boies Schiller Flexner LLP Eric Eisner (1970), lawyer, former president of The Geffen Company and founder of the Young Eisner Scholars program William Barr (1971), attorney general of the United States Arthur Engoron (1971), judge presiding over the New York civil investigation of The Trump Organization Arthur Helton (1971), lawyer, refugee advocate Gerard E. Lynch (1972), judge of the United States District Court for the Southern District of New York Gary Stephen Katzmann (1973), judge on the United States Court of International Trade Robert Katzmann (1973), judge of the United States Court of Appeals for the Second Circuit Eric Holder (1973), United States attorney general under Barack Obama, deputy attorney general under Bill Clinton, United States Attorney for the District of Columbia, judge of the Superior Court of the District of Columbia Jonathan Cuneo (1974), lawyer, founding partner of Cuneo Gilbert & LaDuca, LLP Abbe Lowell (1974), partner at Chadbourne & Parke, chief minority counsel during the Impeachment of Bill Clinton Jeffrey L. Kessler (1975), co-chairman of Winston & Strawn; former global litigation chair at Dewey & LeBoeuf Douglas Letter (1975), general counsel to the United States House of Representatives since 2018 J. Richard Cohen (1976), former president of the Southern Poverty Law Center Joseph A. Greenaway Jr.
Sources: en.wikipedia.org
The version carrying the affinity complex bears a maleimide group that binds serum albumin, which extends its circulation time to several days. The version without it lacks this group and clears within roughly half an hour. The two are chemically related but behave very differently once in the body.
In common usage the name without the affinity complex is often equated with MOD GRF 1-29, a fragment carrying four stabilizing substitutions. Strictly speaking, the term originally referred to the albumin-binding version. The overlap in naming causes frequent ambiguity in both informal and technical writing.
Reversed-phase chromatography separates the peptide from related impurities and yields a purity estimate. Mass spectrometry confirms the molecular mass and detects modifications such as oxidation. Sequence-level checks rely on peptide mapping or amino acid analysis when stronger confirmation is needed.
Chromatography reports how much material elutes as a single peak but does not confirm what that material is. Mass spectrometry supplies the molecular mass, which is characteristic of a given sequence and its modifications. Together the two methods support both a purity figure and an identity claim.